https://listenwithother.co.uk en-gb © 2025-6 Giles Booth Because grown-ups need storytime too. Giles Booth https://listenwithother.co.uk/audio/listen-with-other-rss.xml Short stories with a mystery or whimsical twist. A collection of slightly spooky or strange short stories in short episodes, written, read and recorded by Giles Booth, with occasional guest authors. It carries no advertising, no sponsorship and no generative AI is used in any part of the production process. serial Giles Booth giles.booth@gmail.com trailer Listen with Other: new story trailer Coming soon to Listen with Other, a new six-part story: TOMORROW NEVER KNOWS. 3e536d6b-bbbe-401c-aa82-44ef21cd0616 Sat, 11 Apr 2026 16:57:00 GMT 110 false trailer Listen with Other Trailer Listen with Other is collection of short stories in tiny episodes, written, read and recorded by me, Giles Booth. 09c74a26-86f1-48bb-b3ad-f722024af1ba Sat, 27 Dec 2025 14:45:00 GMT 64 false --> full 8 9 In the final part of The Mind Children, some digital archaeology and two more trips to deepest Somerset uncover even more secrets about the elusive creator of the lost 1970s TV show.
Find out more about this, and other stories in this series, and play The Mind Children adventure game online at the Listen with Other website.
Music by Lee Sparey. Podcast © and ℗ 2026 Giles Booth.]]> 7f3b5602-ff3a-4d71-ad9a-384ef3b586a5 Mon, 21 Sep 2026 17:23:23 GMT 987 false full 7 9 Bob and Dave return with an emergency podcast after Bob makes an extraordinary discovery at a car boot sale in Cornwall. Find out more at the Listen with Other website.
Music by Lee Sparey. Podcast © and ℗ 2026 Giles Booth.]]> 31a1e46d-d042-4d99-b80c-f519e0e54c4e Sat, 19 Sep 2026 17:45:23 GMT 895 false full 6 9 Episode 6 of 6. Bob and Dave finally crack the code and the typescript reveals the shocking conclusion the forgotten TV series never reached. It was written, read and mixed by Giles Booth who also arranged the opening Listen with Mother theme and synth version of ‘The Merry Month of Maying’. The choir version of Now is the Month of Maying was performed by the Tudor Choristers Virtual Choir, directed by Dr Kathleen McGuire and recorded in May 2020 during the Corona Virus lock down. Visit the Tudor Choristers at https://www.tudorchoristers.org.au/ The solo version of Now is the Month of Maying was performed by Georgina Harland. Other original music by Lee Sparey. © and ℗ 2026 Giles Booth. The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA 93951053-405f-49db-b13c-b0f6cc8d69ed Fri, 17 Jul 2026 05:07:23 GMT 1341 false full 5 9 Episode 5 of 6. The Mind Children unexpectedly take the side of a school bully, and Bob and Dave get closer to cracking the code that will unlock the mystery of what happened to the forgotten TV show’s author. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA cad583f5-7eab-4593-8343-385ed33f3bae Sun, 12 Jul 2026 16:11:23 GMT 880 false full 4 9 Episode 4 of 6. The Mind Children are back! Bob and Dave get their hands on a typescript of the unbroadcast final three episodes. In episode 4 The Mind Children conduct an experiment in social and mental engineering at the school Christmas fair. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA bdbb2988-6e1d-4d22-8e26-9a8043035f24 Mon, 6 Jul 2026 14:17:23 GMT 1224 false full 3 9 Episode 3 of 6. Dave is contacted by a listener and drives to deepest Somerset on the trail of the elusive creator of The Mind Children. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. 496ef8b3-9d68-47e4-b123-7f831950f481 Fri, 29 May 2026 21:23:00 GMT 1268 true full 2 9 Episode 2 of 6. Bob and Dave explore episode two of The Mind Children TV show, which tackled the subject of abuse at a boarding school. Then a listener contacts Dave with some extraordinary information about the series' enigmatic creator. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. 4e2ed678-bf70-4567-b1e1-d77136730a19 Mon, 25 May 2026 15:23:00 GMT 908 false full 1 9 Episode 1 of 6. Bob and Dave are the only people who remember a lost 1970s children's TV show called The Mind Children. Reconnected after forty years by social media, the childhood friends start to investigate why it was cancelled after only three episodes, and what happened to its elusive creator. Original music by Lee Sparey. Script and audio mix © and ℗ 2026 Giles Booth. b23c8388-3600-4a1f-827b-c53b2cae0b4d Sun, 24 May 2026 16:23:00 GMT 1384 true full 6 8 Episode 6 of 6. As the big vote approaches, Kim makes a discovery about her family. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. dc327671-d4a5-4452-824f-029ccabfa93c Sun, 3 May 2026 23:00:00 GMT 976 false full 5 8 Episode 5 of 6. It's Kim's birthday and Roland has an unusual gift for her. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. 4ed98ecc-cd40-4fed-87b7-a250cbdfea55 Sat, 2 May 2026 16:42:00 GMT 900 true full 4 8 Episode 4 of 6. Roland helps Kim hatch a plan to escape the island using an ancient path across the mud. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. 89b80b4c-9432-46c1-9e65-00e687c5c9c1 Tue, 28 Apr 2026 05:34:00 GMT 1020 false full 3 8 Episode 3 of 6. As Kim's stay on the island is extended she makes friends with two children who help her understand more about what's really going on, on the island and beyond. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. 03d632b0-feae-47db-a54a-5159a566e37f Thu, 23 Apr 2026 17:42:00 GMT 960 false full 2 8 Episode 2 of 6. Kim arrives on the island, meets her grandfather who lives in the castle, and discovers the place is not quite as welcoming as she remembered it. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. 3c222fab-1d79-4c5e-949f-6cb4576e9896 Sun, 19 Apr 2026 14:42:00 GMT 974 false full 1 8 Episode 1 of 6. Kim never knew her mother. She lives above the town bookshop with her father, dreaming of a time when rationing will end. When her father is called away, she is on the cusp of discovering more about her family, and the world around her. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. 846a533a-d614-45df-9a2a-fdfc7ba410d0 Thu, 16 Apr 2026 06:17:00 GMT 1041 false full 1 7 Episode 1 of 3. When Andrew's wife dies, he decides to take a short lease on a cottage in a fishing village in Cornwall to try to come to terms with his loss. He meets the curator of the eccentric local museum he and his wife had first discovered many years before. Cover image of Puck public domain, from Fun magazine, 2nd September 1865 via Hathi Trust. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. 336f1229-0f7e-401a-9681-3610ce05c690 Tue, 17 Mar 2026 21:17:00 GMT 733 false full 2 7 Episode 2 of 3. Andrew meets the museum's caretaker and discovers its most valuable asset. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. bcb49c24-98db-4df1-b0ec-848bb1cbfab7 Tue, 17 Mar 2026 21:17:00 GMT 568 false full 3 7 Episode 3 of 3. Andrew becomes obsessed with the ancient telegraph cable that lands on the beach and decides to see if it is still connected. Written, read and mixed by Giles Booth. Original music by Lee Sparey. © and ℗ 2026 Giles Booth. c611b876-2ec9-4096-bf65-d39a07b7684c Tue, 17 Mar 2026 21:17:00 GMT 802 false full 1 6 Episode 1 of 3. Go back in time to the early 2000s when the staff of a tiny British computer company are struggling to produce a new personal digital assistant called the MagicSlate. Join these four conflicting forces on a team-building exercise which has unintended consequences in every direction. Written, read and mixed by Giles Booth. © and ℗ 2026 Giles Booth. 1c5cfe0e-bc10-4b88-a1b0-4e50cf274e89 Sun, 8 Mar 2026 13:17:00 GMT 993 true full 2 6 Episode 2 of 3. The four colleagues face their first team-building challenge of the day: work together to navigate a swamp. Theme music arranged by Giles Booth. Incidental music © Lee Sparey. Written, read and mixed by Giles Booth. © and ℗ 2026 Giles Booth. 5c74d62d-3881-4d7d-b136-16a558d162c3 Sun, 8 Mar 2026 13:17:00 GMT 946 true full 3 6 Episode 3 of 3. Tempers fray as the four colleagues are split into two teams to embark on a treasure hunt. Theme music arranged by Giles Booth. Incidental music © Lee Sparey. Written, read and mixed by Giles Booth. © and ℗ 2026 Giles Booth. cfe6d531-a518-49aa-9630-ce1f5989ff73 Sun, 8 Mar 2026 13:17:00 GMT 1069 true full 1 5 Episode 1 of 1. Guest author Ray Newman, author of Municipal Gothic and Intervals of Darkness, reads a new story: The Interchange. Nobody knows who built the new exit road at Old Barn roundabout near the motorway interchange, when, or why. What is certain is that anybody who drives that way disappears. Every attempt by the authorities to investigate only raises more questions, and suggests new and more sinister possibilities. Story and original music © 2026 Ray Newman. Episode mix ℗ 2026 Giles Booth. 5dcb2e48-2e0c-4395-99be-823af68b63f1 Tue, 10 Feb 2026 08:50:00 GMT 972 false full 1 4 Episode 1 of 3. Enter the world of an enigmatic academic, hidden at the top of a dilapidated brutalist concrete university tower, a professor of paranormal computing, looking for patterns in random noise, and debunking stories of the unexplained. A persistent podcast researcher interrupts their near-solitude, leading to an investigation of a legend surrounding the fate of any student unlucky enough to be assigned room 623. Content warning: contains references to suicide. 524ab2ca-e1aa-4127-84b4-405bebc0755a Sun, 1 Feb 2026 06:23:00 GMT 600 true full 2 4 Episode 2 of 3. The professor goes in search of the real room 623. Content warning: contains references to suicide. 18ba81ba-bd44-443c-8563-780260ec1ac8 Sun, 1 Feb 2026 06:23:00 GMT 605 false full 3 4 Episode 3 of 3. The professor gets a wrong number. Is it a prank - or something more sinister? Content warning: contains references to suicide. f895e8e9-6632-469c-8d31-6ac2408a84b1 Sun, 1 Feb 2026 06:23:00 GMT 523 false full 2 3 Episode 2 of 2. Two strangers attempt to unravel the mystery of the Ring O'Bells. 31339505-cd09-48e7-8e2b-c6ce2812911 Tue, 6 Jan 2026 10:23:00 GMT 600 false full 1 3 Episode 1 of 2. Discover how 1970s family Ouija board sessions come back to haunt our narrator in the present day. 6612c15c-3e99-43f2-909f-79deb2ec9b3c Tue, 6 Jan 2026 10:23:00 GMT 570 false full 4 2 Episode 4 of 4. Christmas Day does not quite go to plan. 2f01f971-37d0-47e4-9b7f-d233e175abe1 Sun, 21 Dec 2025 13:00:00 GMT 389 false full 3 2 Episode 3 of 4. Lucy and Tom explore a strange room in the loft. 11eabc51-7f8a-44c7-91b8-2891b801ddf9 Sun, 21 Dec 2025 13:00:00 GMT 486 true full 2 2 Episode 2 of 4. Lucy and Tom's first day in the cottage takes a strange turn. 380b5efd-3656-4878-8125-505df08a9b4f Sun, 21 Dec 2025 13:00:00 GMT 437 false full 1 2 Episode 1 of 4. Lucy and Tom reluctantly go away for Christmas with their dad and his girlfriend. ddeb5006-5f00-48c7-833d-56389225db9a Sun, 21 Dec 2025 13:00:00 GMT 434 false full 3 1 Episode 3 of 3. The trio meet some merry milkmaids and have a life-changing experience. f57e786f-84cd-413b-8ff2-cf2a0783492d Sat, 27 Sep 2025 08:00:00 GMT 720 true full 2 1 Episode 2 of 3. An unexpected visitor interrupts Kate and Ian's getaway. 6fa17b0c-b64d-4963-a0e6-f056ccbbd3d9 Sat, 27 Sep 2025 08:00:00 GMT 1154 true full 1 1 Episode 1 of 3. Kate's birthday fell just after new year so it was always a struggle finding people in the mood to party. Hoping to exorcise the memory of a disastrous birthday party five years ago, her husband lan books a getaway in rural Somerset. Unfinished business with Margate Louise, a friend they lost touch with, a storm called Arthur and a stone circle that is not what it seems, ensure that this new year and birthday do not go to plan... 051ec404-283e-4925-94a9-0ed710c0e412 Sat, 27 Sep 2025 08:00:00 GMT 810 true